Anti-TGF-beta receptor-associated protein 1 antibody (ab122468)

Overview

  • Product nameAnti-TGF-beta receptor-associated protein 1 antibody
  • Description
    Rabbit polyclonal to TGF-beta receptor-associated protein 1
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TGF-beta receptor-associated protein 1 aa 712-807 (internal sequence).
    Sequence:

    RQQLFHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTW SVQLLCPFLMGAMRDSIHARRTMQVALGLARSENLIYTYDKMKLKG

  • Positive control
    • Human pancreas tissue; RT 4 and U 251 MG cell lysates.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab122468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.

Target

  • FunctionPlays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling. May recruit SMAD4 to the vicinity of the receptor complex and facilitate its interaction with receptor-regulated Smads, such as SMAD2.
  • Sequence similaritiesBelongs to the TRAP1 family.
    Contains 1 CNH domain.
  • Cellular localizationCytoplasm. Colocalizes with TGF-beta receptors in the absence of signaling.
  • Information by UniProt
  • Database links
  • Alternative names
    • TGF-beta receptor-associated protein 1 antibody
    • TGFA1_HUMAN antibody
    • Tgfbrap1 antibody
    • Transforming growth factor-beta receptor-associated protein 1 antibody
    • TRAP-1 antibody
    • TRAP1 antibody
    • VPS3 antibody
    see all

Anti-TGF-beta receptor-associated protein 1 antibody images

  • ab122468, at 1/10 dilution, staining TGF-beta receptor-associated protein 1 in paraffin-embedded Human pancreas tissue by Immunohistochemistry.

  • All lanes : Anti-TGF-beta receptor-associated protein 1 antibody (ab122468) at 1/250 dilution

    Lane 1 : RT 4 cell lysate
    Lane 2 : U 251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique

References for Anti-TGF-beta receptor-associated protein 1 antibody (ab122468)

ab122468 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"