Overview

  • Product name
  • Description
    Rabbit polyclonal to TGIF
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human TGIF aa 294-358. Numbering is from isoform 1; the sequence also occurs in isoforms 2, 3 and 4.
    Sequence:

    SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLM YPEDTCKSGPSTNTQ


    Database link: Q15583

  • Positive control
    • RT4 cell line; A549 cells
  • General notes

    Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Properties

Applications

Our Abpromise guarantee covers the use of ab220965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 43 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Binds to a retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE). Inhibits the 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element. Active transcriptional corepressor of SMAD2. Links the nodal signaling pathway to the bifurcation of the forebrain and the establishment of ventral midline structures. May participate in the transmission of nuclear signals during development and in the adult, as illustrated by the down-modulation of the RXR alpha activities.
  • Involvement in disease
    Holoprosencephaly 4
  • Sequence similarities
    Belongs to the TALE/TGIF homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 5' TG 3' interacting factor antibody
    • 5''-TG-3''-interacting factor 1 antibody
    • Homeobox protein TGIF antibody
    • Homeobox protein TGIF1 antibody
    • HPE4 antibody
    • MGC39747 antibody
    • MGC5066 antibody
    • TALE homeobox TG-interacting factor antibody
    • TG interacting factor isoform c antibody
    • TG-interacting factor antibody
    • TGFB induced factor antibody
    • TGFB-induced factor homeobox 1 antibody
    • TGIF1 antibody
    • TGIF1_HUMAN antibody
    • transforming growth factor-beta-induced factor antibody
    see all

Images

  • Anti-TGIF antibody (ab220965) at 1/100 dilution + RT4 cell extract
    Developed using the ECL technique

    Predicted band size : 43 kDa
  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A549 cells labeling TGIF with ab220965 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab220965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up