Anti-THUMPD1 antibody - C-terminal (ab182545)

Overview

  • Product name
    Anti-THUMPD1 antibody - C-terminal
    See all THUMPD1 primary antibodies
  • Description
    Rabbit polyclonal to THUMPD1 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Guinea pig
  • Immunogen

    Synthetic peptide within Human THUMPD1 aa 304-353 (C terminal). The exact sequence is proprietary.
    Sequence:

    KNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNENDFS


    Database link: Q9NXG2

  • Positive control
    • MCF7 whole cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa.

Target

Images

  • Anti-THUMPD1 antibody - C-terminal (ab182545) at 1 µg/ml + MCF7 whole cell lysate at 10 µg

    Predicted band size : 39 kDa

    5% milk used for blocking

References

ab182545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up