
  • Product name
    Anti-THYN1 antibody
  • Description
    Rabbit polyclonal to THYN1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 143-192 (NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL K) of Human THYN1 (NP_054893).

  • Positive control
    • Human fetal muscle nuclear lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab82750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    The THYN1 gene encodes a protein which is highly conserved among vertebrates and plant species, and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.
  • Cellular localization
  • Database links
  • Alternative names
    • HSPC144 antibody
    • MDS012 antibody
    • MGC12187 antibody
    • MY105 antibody
    • THY28 antibody
    • THY28KD antibody
    • thymocyte nuclear protein 1 antibody
    • Thymocyte protein Thy28 antibody
    see all

Anti-THYN1 antibody images

References for Anti-THYN1 antibody (ab82750)

ab82750 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82750.
Please use the links above to contact us or submit feedback about this product.


Sign up