Overview

  • Product nameAnti-TIGD3 antibody
    See all TIGD3 primary antibodies
  • Description
    Rabbit polyclonal to TIGD3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 396-445 (

    VDLEGEEPRSGVCKEEIGTEDEKGDREGAFEPLPTKADALRALGTLRRWF

    ) of Human TIGD3 (NP_663771).

  • Positive control
    • PANC-1 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab90265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceTIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 is not known.
  • Cellular localizationNucleus; chromosome centromeric region.
  • Database links
  • Alternative names
    • MGC60957 antibody
    • MGC67569 antibody
    • Tigger transposable element derived 3 antibody

Anti-TIGD3 antibody images

  • Anti-TIGD3 antibody (ab90265) at 1 µg/ml + PANC-1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa

References for Anti-TIGD3 antibody (ab90265)

ab90265 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"