Anti-TIGD5 antibody - N-terminal (ab177382)

Overview

  • Product name
    Anti-TIGD5 antibody - N-terminal
  • Description
    Rabbit polyclonal to TIGD5 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Chicken, Cow, Dog, Human
  • Immunogen

    Synthetic peptide within Mouse TIGD5 aa 38-87 (N terminal). The exact sequence is proprietary. NP_848761
    Sequence:

    PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV


    Database link: Q499M4

  • Positive control
    • Mouse liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 70 kDa.

Target

  • Relevance
    TIGD5 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.
  • Cellular localization
    Nuclear, centromeric region
  • Database links
  • Alternative names
    • FLJ14926 antibody
    • MGC44883 antibody
    • Tigger transposable element derived 5 antibody
    • Tigger transposable element derived protein 5 antibody

Images

  • Anti-TIGD5 antibody - N-terminal (ab177382) at 1 µg/ml + Mouse liver lysate at 10 µg

    Predicted band size : 70 kDa

References

ab177382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up