Anti-TIMP3 antibody - C-terminal (ab187297)

Overview

  • Product name
    Anti-TIMP3 antibody - C-terminal
    See all TIMP3 primary antibodies
  • Description
    Rabbit polyclonal to TIMP3 - C-terminal
  • Tested applications
    Suitable for: WB, IHC-P, Flow Cyt, IP, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Horse, Cow, Dog, Human
  • Immunogen

    Recombinant fragment corresponding to Human TIMP3 aa 175-211 (C terminal).
    Sequence:

    PGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP


    Database link: P35625

  • Positive control
    • Human Placenta or Human breast carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab187297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 24 kDa.
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use 0.5-1µg for 106 cells. ab171870-Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.
IP Use at 2-4 µg/mg of lysate.
ICC/IF Use a concentration of 1 - 2 µg/ml.

Target

  • Function
    Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
  • Involvement in disease
    Defects in TIMP3 are the cause of Sorsby fundus dystrophy (SFD) [MIM:136900]. SFD is a rare autosomal dominant macular disorder with an age of onset in the fourth decade. It is characterized by loss of central vision from subretinal neovascularization and atrophy of the ocular tissues. Generally, macular disciform degeneration develops in the patients eye within 6 months to 6 years.
  • Sequence similarities
    Belongs to the protease inhibitor I35 (TIMP) family.
    Contains 1 NTR domain.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • HSMRK222 antibody
    • K222 antibody
    • K222TA2 antibody
    • Metalloproteinase inhibitor 3 antibody
    • MIG 5 protein antibody
    • MIG5 protein antibody
    • Protein MIG 5 antibody
    • Protein MIG-5 antibody
    • SFD antibody
    • Sorsby fundus dystrophy pseudoinflammatory antibody
    • TIMP 3 antibody
    • TIMP metallopeptidase inhibitor 3 antibody
    • TIMP-3 antibody
    • TIMP3 antibody
    • TIMP3_HUMAN antibody
    • Tissue Inhibitor of Metalloproteinase 3 antibody
    • Tissue inhibitor of metalloproteinases 3 antibody
    • Tissue inhibitor of metalloproteinases3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue labeling TIMP3 with ab187297 at 2 µg/ml.

References

ab187297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up