Overview

  • Product name
  • Description
    Mouse polyclonal to TIPIN
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TIPIN aa 1-301. (AAH00870.1)
    Sequence:

    MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGA PVPVPPKRTVKRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDL KMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPIL HEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQ QRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKE ESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEA R


    Database link: Q9BVW5

  • Positive control
    • TIPIN transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.

Target

  • Function
    Required for normal progression of S-phase. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light.
  • Sequence similarities
    Belongs to the CSM3 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ20516 antibody
    • TIMELESS interacting protein antibody
    • TIMELESS-interacting protein antibody
    • TIPIN antibody
    • TIPIN_HUMAN antibody
    see all

Images

  • All lanes : Anti-TIPIN antibody (ab172792) at 1 µg/ml

    Lane 1 : TIPIN transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat Anti-Mouse IgG at 1/2500 dilution

    Predicted band size : 35 kDa

References

ab172792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up