Overview

  • Product nameAnti-TIS11B antibody
    See all TIS11B primary antibodies
  • Description
    Rabbit polyclonal to TIS11B
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human TIS11B aa 66-115.
    Sequence:

    QLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRY


    Database link: Q07352

  • Positive control
    • Human placenta lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab35801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/62500.

Target

Anti-TIS11B antibody images

  • Anti-TIS11B antibody (ab35801) at 0.5 µg/ml (in 5% skim milk / PBS buffer) + Human placental lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 50000

    Predicted band size : 38 kDa
    Observed band size : 45 kDa (why is the actual band size different from the predicted?)

References for Anti-TIS11B antibody (ab35801)

This product has been referenced in:
  • Vignudelli T  et al. ZFP36L1 negatively regulates erythroid differentiation of CD34+ hematopoietic stem cells by interfering with the Stat5b pathway. Mol Biol Cell 21:3340-51 (2010). Read more (PubMed: 20702587) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab35801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"