Overview

  • Product name
  • Description
    Rabbit polyclonal to TIS11B
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human TIS11B aa 66-115.
    Sequence:

    QLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRY


    Database link: Q07352

  • Positive control
    • Human placenta lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab35801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/62500.

Target

Images

  • Anti-TIS11B antibody (ab35801) at 0.5 µg/ml (in 5% skim milk / PBS buffer) + Human placental lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 50000

    Predicted band size : 38 kDa
    Observed band size : 45 kDa (why is the actual band size different from the predicted?)

References

This product has been referenced in:
  • Vignudelli T  et al. ZFP36L1 negatively regulates erythroid differentiation of CD34+ hematopoietic stem cells by interfering with the Stat5b pathway. Mol Biol Cell 21:3340-51 (2010). Read more (PubMed: 20702587) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab35801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up