Overview

  • Product name
  • Description
    Rabbit polyclonal to TIS11B
  • Tested applications
    Suitable for: ELISA, WB, EMSAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human TIS11B aa 46-95 (N terminal). The immunogen was taken from within these 50aa's
    Sequence:

    GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG


    Database link: Q07352

  • Positive control
    • Human placenta lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab42473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 0.125 µg/ml. Detects a band of approximately 30 kDa (predicted molecular weight: 36 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
EMSA Use at an assay dependent dilution. PubMed: 20691152

Target

Images

  • Anti-TIS11B antibody (ab42473) at 0.125 µg/ml (5% skimmed milk / PBS) + 10µg Human placenta whole cell lysate

    Secondary
    HRP conjugated anti-rabbit at 1/50000 dilution

    Predicted band size : 36 kDa
    Observed band size : 30 kDa (why is the actual band size different from the predicted?)
    Gel concentration 12%.

References

This product has been referenced in:
  • Kim CW  et al. Ectopic over-expression of tristetraprolin in human cancer cells promotes biogenesis of let-7 by down-regulation of Lin28. Nucleic Acids Res : (2011). WB ; Human . Read more (PubMed: 22210895) »
  • Kim CW  et al. Tristetraprolin controls the stability of cIAP2 mRNA through binding to the 3'UTR of cIAP2 mRNA. Biochem Biophys Res Commun 400:46-52 (2010). EMSA ; Human . Read more (PubMed: 20691152) »

See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab42473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up