Overview

  • Product name
  • Description
    Guinea pig polyclonal to TJP2
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Frmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Dog, Chimpanzee
  • Immunogen

    Synthetic peptide: NRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFK STGDIAG, corresponding to amino acids 411-467 of Human TJP2

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.02% Sodium Azide
    Constituents: 0.1% BSA, PBS
  • Concentration information loading...
  • Purity
    IgG fraction
  • Purification notes
    0.2µm filtered solution.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab59725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50.
WB 1/50. Predicted molecular weight: 134 kDa.
IHC-Fr 1/50.

Target

  • Function
    Plays a role in tight junctions and adherens junctions.
  • Tissue specificity
    This protein is found in epithelial cell junctions. Isoform A1 is abundant in the heart and brain. Detected in brain and skeletal muscle. It is present almost exclusively in normal tissues. Isoform C1 is expressed at high level in the kidney, pancreas, heart and placenta. Not detected in brain and skeletal muscle. Found in normal as well as in most neoplastic tissues.
  • Involvement in disease
    Defects in TJP2 are involved in familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
  • Sequence similarities
    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Cellular localization
    Cell junction > adherens junction. Cell membrane. Cell junction > tight junction. Nucleus. Also nuclear under environmental stress conditions and in migratory endothelial cells and subconfluent epithelial cell cultures.
  • Information by UniProt
  • Database links
  • Alternative names
    • C9DUPq21.11 antibody
    • DFNA51 antibody
    • DUP9q21.11 antibody
    • Friedreich ataxia region gene X104 (tight junction protein ZO-2) antibody
    • MGC26306 antibody
    • PFIC4 antibody
    • Tight junction protein 2 antibody
    • Tight junction protein ZO 2 antibody
    • Tight junction protein ZO-2 antibody
    • TJP2 antibody
    • X104 antibody
    • ZO 2 antibody
    • ZO-2 antibody
    • ZO2 antibody
    • ZO2_HUMAN antibody
    • Zona occludens 2 antibody
    • Zona occludens protein 2 antibody
    • Zonula occludens protein 2 antibody
    see all

References for Anti-TJP2 antibody (ab59725)

ab59725 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab59725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up