Overview

  • Product name
  • Description
    Mouse polyclonal to TLL1
  • Specificity
    Detects Isoform 2 of O43897.
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human TLL1 aa 1-392.
    Sequence:

    MGLGTLSPRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDY KDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHA MSKKRGALYQLIDRIRRIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAAT SRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEE SYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWH EHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYA RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACG ETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKVVFSLC


    Database link: O43897-2

  • Positive control
    • TLL1 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab167664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa.

Target

  • Function
    Protease which processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.
  • Involvement in disease
    Defects in TLL1 are the cause of atrial septal defect type 6 (ASD6) [MIM:613087]. A congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria.
  • Sequence similarities
    Belongs to the peptidase M12A family.
    Contains 5 CUB domains.
    Contains 2 EGF-like domains.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • ASD6 antibody
    • TLL antibody
    • TLL1 antibody
    • TLL1_HUMAN antibody
    • Tolloid like 1 antibody
    • Tolloid-like protein 1 antibody
    see all

Images

  • All lanes : Anti-TLL1 antibody (ab167664) at 1 µg/ml

    Lane 1 : TLL1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.


    Predicted band size : 44 kDa
    Observed band size : 44 kDa

References

ab167664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up