Overview

  • Product nameAnti-TLR1 antibody
    See all TLR1 primary antibodies
  • Description
    Rabbit polyclonal to TLR1
  • Tested applicationsSuitable for: WB, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
    Does not react with: Mouse
  • Immunogen

    Synthetic peptide:

    LQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKV L

    conjugated to KLH, corresponding to amino acids 400-450 of Human TLR1.

  • Positive control
    • Ramos

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab22057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 3 µg/ml. Detects a band of approximately 87 kDa.
Flow Cyt Use 2-4µg for 106 cells. ab171870-Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • FunctionParticipates in the innate immune response to microbial agents. Cooperates with TLR2 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificityUbiquitous. Highly expressed in spleen, ovary, peripheral blood leukocytes, thymus and small intestine.
  • Sequence similaritiesBelongs to the Toll-like receptor family.
    Contains 12 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Cellular localizationCell membrane. Cytoplasmic vesicle > phagosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD281 antibody
    • CD281 antigen antibody
    • KIAA0012 antibody
    • LPRS5 antibody
    • rsc786 antibody
    • TIL antibody
    • TIL. LPRS5 antibody
    • Tlr1 antibody
    • TLR1_HUMAN antibody
    • Toll (Drosophila) homolog antibody
    • Toll like receptor 1 antibody
    • Toll-like receptor 1 antibody
    • Toll/interleukin-1 receptor-like protein antibody
    see all

Anti-TLR1 antibody images

  • All lanes : Anti-TLR1 antibody (ab22057) at 2 µg/ml

    Lane 1 : Ramos whole cell lysate (ab3955)
    Lane 2 : RAW 264.7 whole cell lysate (ab7187)


    Observed band size : 87 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 190 kDa,32 kDa,60 kDa. We are unsure as to the identity of these extra bands.
  • ab22057, at 4ug/106, staining TLR1 in permeabilised Ramos cells by flow ctometric analysis (open histogram).

References for Anti-TLR1 antibody (ab22057)

This product has been referenced in:
  • Yokota S  et al. Highly-purified Helicobacter pylori LPS preparations induce weak inflammatory reactions and utilize Toll-like receptor 2 complex but not Toll-like receptor 4 complex. FEMS Immunol Med Microbiol 51:140-8 (2007). Read more (PubMed: 17645528) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab22057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"