Overview

  • Product nameAnti-TLR5 antibody
    See all TLR5 primary antibodies
  • Description
    Goat polyclonal to TLR5
  • SpecificityPeptide sequence is < 50 % identical to other human TLR receptors in this region.
  • Tested applicationsSuitable for: WB, ELISA, ICC, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide:

    DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ

    , corresponding to amino acids 151-181 of Human TLR5.

  • Positive control
    • Human spleen sections or human peripheral blood.
  • General notes


    Receptors for the C - C chemokine family include CCR 1, CCR 2A, CCR 3, CCR 4, CCR 5 and the Duffy blood group antigen. The C C receptors are important in the function of T cell chemotaxis and migration of phagocytic cells to sites of inflammation.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPBS, 1mg/ml BSA, 0.1% sodium azide, pH7.2
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Primary antibody notesReceptors for the C - C chemokine family include CCR 1, CCR 2A, CCR 3, CCR 4, CCR 5 and the Duffy blood group antigen. The C C receptors are important in the function of T cell chemotaxis and migration of phagocytic cells to sites of inflammation.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab1654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100.
ELISA 1/75000.
ICC 1/500.
IHC-P 1/250.

Target

  • FunctionParticipates in the innate immune response to microbial agents. Mediates detection of bacterial flagellins. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificityHighly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis.
  • Involvement in diseaseSystemic lupus erythematosus 1
  • Sequence similaritiesBelongs to the Toll-like receptor family.
    Contains 22 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Post-translational
    modifications
    Phosphorylated at Ser-805 by PKD/PRKD1; phosphorylation induces the production of inflammatory cytokines.
    Phosphorylated at Tyr-798 upon flagellin binding; required for signaling.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ10052 antibody
    • MGC126430 antibody
    • MGC126431 antibody
    • SLEB1 antibody
    • TIL 3 antibody
    • TIL3 antibody
    • TLR 5 antibody
    • Tlr5 antibody
    • TLR5_HUMAN antibody
    • Toll like receptor 5 antibody
    • Toll like receptor 5 precursor antibody
    • Toll-like receptor 5 antibody
    • Toll/interleukin 1 receptor like protein 3 antibody
    • Toll/interleukin-1 receptor-like protein 3 antibody
    see all

Anti-TLR5 antibody images

  • Immunohistochemistry with ab1654 on paraffin section of human spleen

References for Anti-TLR5 antibody (ab1654)

This product has been referenced in:
  • Kim WY  et al. Increased expression of Toll-like receptor 5 during progression of cervical neoplasia. Int J Gynecol Cancer 18:300-5 (2008). Read more (PubMed: 17587322) »
  • Maaser C  et al. Human intestinal microvascular endothelial cells express Toll-like receptor 5: a binding partner for bacterial flagellin. J Immunol 172:5056-62 (2004). Read more (PubMed: 15067088) »

See all 2 Publications for this product

Product Wall

Thank you for your email. Ab1654 is only available in the form indicated on the online datasheet - PBS, 1mg/ml BSA, 0.1% sodium azide, pH 7.2 - and we can't provide it sodium azide free. If you have any additional questions please contact us again.

We do not have any information about the suitability of this antibody for use in blocking studies.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"