Overview

  • Product nameAnti-TLR8 antibody
    See all TLR8 primary antibodies
  • Description
    Goat polyclonal to TLR8
  • Tested applicationsSuitable for: WB, ICC, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide:

    CESFQGLQNLTKINLNHNPNVQHQNGNPGI

    , corresponding to amino acids 81-109 of Human TLR8

  • Positive control
    • Mouse spleen and human tonsil tissue.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab53630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 119 kDa.
ICC 1/400. Acetone fixed.
IHC-P Use at an assay dependent dilution.

Target

  • FunctionKey component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificityDetected in brain, heart, lung, liver, placenta, in monocytes, and at lower levels in CD11c+ immature dendritic cells.
  • Sequence similaritiesBelongs to the Toll-like receptor family.
    Contains 23 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD 288 antibody
    • CD288 antibody
    • CD288 antigen antibody
    • MGC119599 antibody
    • MGC119600 antibody
    • TLR 8 antibody
    • Tlr8 antibody
    • TLR8_HUMAN antibody
    • Toll like receptor 8 antibody
    • Toll-like receptor 8 antibody
    see all

Anti-TLR8 antibody images

  • ab53630 at 1/250 dilution staining TLR8 in mouse spleen by Immunohistochemistry, Paraffin embedded tissue.
  • ab53630 at 1/250 dilution staining TLR8 in human tonsil by Immunohistochemistry, Paraffin embedded tissue.

References for Anti-TLR8 antibody (ab53630)

This product has been referenced in:
  • Thiyagarajan D  et al. Silencing of Renal DNaseI in Murine Lupus Nephritis Imposes Exposure of Large Chromatin Fragments and Activation of Toll Like Receptors and the Clec4e. PLoS One 7:e34080 (2012). Read more (PubMed: 22479529) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab53630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"