Overview

  • Product nameAnti-TM2D3 antibody
  • Description
    Rabbit polyclonal to TM2D3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog, Human, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 171-220 (

    TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGY

    ) of Mouse TM2D3 (NP_081071; Q8BJ83 isoform 2).

  • Positive control
    • Mouse heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-TM2D3 antibody images

  • Anti-TM2D3 antibody (ab122957) at 1 µg/ml + Mouse heart lysate at 10 µg

    Predicted band size : 27 kDa

References for Anti-TM2D3 antibody (ab122957)

ab122957 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"