Overview

  • Product name
  • Description
    Rabbit polyclonal to TMED1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Sheep, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human TMED1 aa 50-100. The exact sequence is proprietary. NCBI Accession No. NP_006849.1
    Sequence:

    APANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTE A


    Database link: Q13445

  • Positive control
    • HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH 3T3 whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 25 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function
      Potential role in protein trafficking.
    • Tissue specificity
      Widely expressed.
    • Sequence similarities
      Belongs to the EMP24/GP25L family.
      Contains 1 GOLD domain.
    • Cellular localization
      Cell membrane.
    • Information by UniProt
    • Database links
    • Alternative names
      • IL1RL1 binding protein antibody
      • IL1RL1L antibody
      • IL1RL1LG antibody
      • Interleukin-1 receptor-like 1 ligand antibody
      • Interleukin1 receptor like 1 ligand antibody
      • MGC1270 antibody
      • p24 family protein gamma 1 antibody
      • p24gamma1 antibody
      • Putative T1/ST2 receptor binding protein antibody
      • Putative T1/ST2 receptor-binding protein antibody
      • ST2L antibody
      • T1/ST2 receptor binding protein antibody
      • TMED 1 antibody
      • Tmed1 antibody
      • TMED1_HUMAN antibody
      • Tp24 antibody
      • Transmembrane emp24 domain containing 1 antibody
      • Transmembrane emp24 domain containing protein 1 antibody
      • Transmembrane emp24 domain-containing protein 1 antibody
      • Transmembrane emp24 protein transport domain containing 1 antibody
      • Transmembrane p24 trafficking protein 1 antibody
      see all

    Images

    • All lanes : Anti-TMED1 antibody (ab191212) at 1 µg/ml

      Lane 1 : Jurkat whole cell lysate prepared using NETN lysis buffer
      Lane 2 : Jurkat whole cell lysate prepared using RIPA lysis buffer
      Lane 3 : HeLa whole cell lysate prepared using NETN lysis buffer
      Lane 4 : 293T whole cell lysate prepared using NETN lysis buffer
      Lane 5 : mouse TCMK-1 whole cell lysate prepared using NETN lysis buffer
      Lane 6 : mouse NIH 3T3 whole cell lysate prepared using NETN lysis buffer

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 25 kDa


      Exposure time: 30 seconds

    References

    ab191212 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab191212.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up