Overview

  • Product name
  • Description
    Rabbit polyclonal to TMEM127
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide derived from within residues:

    LSAFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQ

    , corresponding to amino acids 107-156 of Human TMEM127

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab80846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Controls cell proliferation acting as a negative regulator of TOR signaling pathway mediated by mTORC1. May act as a tumor suppressor.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in TMEM127 are a cause of susceptibility to pheochromocytoma (PCC) [MIM:171300]. A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.
  • Sequence similarities
    Belongs to the TMEM127 family.
  • Cellular localization
    Cell membrane. Cytoplasm. Association of TMEM127 with the cell membrane is enhanced by inhibition of endocytosis. In the cytoplasm, it colocalizes with markers of early endosomal structures, Golgi apparatus and lysosomes.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ20507 antibody
    • FLJ22257 antibody
    • TM127_HUMAN antibody
    • Tmem127 antibody
    • Transmembrane protein 127 antibody
    see all

Anti-TMEM127 antibody images

  • Anti-TMEM127 antibody (ab80846) at 1 µg/ml + Transfected 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 26 kDa
    Observed band size : 26 kDa
    Additional bands at : 52 kDa. We are unsure as to the identity of these extra bands.

References for Anti-TMEM127 antibody (ab80846)

ab80846 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab80846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up