Anti-TMEM132D antibody (ab116041)

Overview

  • Product nameAnti-TMEM132D antibody
    See all TMEM132D primary antibodies
  • Description
    Rabbit polyclonal to TMEM132D
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 700-749(

    QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK

    ) of Mouse TMEM132D (NP_766473).

  • Positive control
    • Mouse liver lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 2% Sucrose, 97% PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab116041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 122 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-TMEM132D antibody images

  • Anti-TMEM132D antibody (ab116041) at 1 µg/ml + mouse liver lysate at 10 µg

    Predicted band size : 122 kDa

References for Anti-TMEM132D antibody (ab116041)

ab116041 has not yet been referenced specifically in any publications.

Product Wall

Thank you for taking the time to complete our questionnaire and contact us. I am sorry to hear you have had difficulty obtaining satisfactory results from this antibody.
The details you have kindly provided will enable us to investigate this case ...

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Rat Cell lysate - whole cell (INS1 cells)
Loading amount 30000 cells
Specification INS1 cells
Gel Running Conditions Reduced Denaturing (8 %)
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Username

Dr. Olatz Villate

Verified customer

Submitted Mar 15 2012

Thank you for contacting us.
Ab116041 has never been tested in rat. It doesn’t mean it won’t work in this species, but we don’t have data to support it. I performed a BLAST to evaluate the percentage of homology with rat species, and it’s very lik...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"