Anti-TMEM132D antibody (ab116041)

Overview

  • Product name
    Anti-TMEM132D antibody
  • Description
    Rabbit polyclonal to TMEM132D
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 700-749(

    QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK

    ) of Mouse TMEM132D (NP_766473).

  • Positive control
    • Mouse liver lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 2% Sucrose, 97% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab116041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 122 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-TMEM132D antibody (ab116041) at 1 µg/ml + mouse liver lysate at 10 µg

    Predicted band size : 122 kDa

References

ab116041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for taking the time to complete our questionnaire and contact us. I am sorry to hear you have had difficulty obtaining satisfactory results from this antibody.
The details you have kindly provided will enable us to investigate this case ...

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Rat Cell lysate - whole cell (INS1 cells)
Loading amount
30000 cells
Specification
INS1 cells
Gel Running Conditions
Reduced Denaturing (8 %)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Username

Dr. Olatz Villate

Verified customer

Submitted Mar 15 2012

Thank you for contacting us.
Ab116041 has never been tested in rat. It doesn’t mean it won’t work in this species, but we don’t have data to support it. I performed a BLAST to evaluate the percentage of homology with rat species, and it’s very lik...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up