Overview

  • Product name
    Anti-TMEM14B antibody
  • Description
    Rabbit polyclonal to TMEM14B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TMEM14B aa 1-114.
    Sequence:

    MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAG LGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLL MAAKVGVRMLMTSD


    Database link: Q9NUH8

  • Positive control
    • WB: K562 whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    >95%
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 12 kDa (predicted molecular weight: 12 kDa).
ELISA Use at an assay dependent concentration.

Target

  • Sequence similarities
    Belongs to the UPF0136 (TMEM14) family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ60468 antibody
    • MGC1223 antibody
    • OTTHUMP00000214289 antibody
    • OTTHUMP00000214290 antibody
    • OTTHUMP00000214297 antibody
    • OTTHUMP00000214298 antibody
    • OTTHUMP00000214299 antibody
    • RP3-417M14.1 antibody
    • TM14B_HUMAN antibody
    • TMEM14B antibody
    • Transmembrane protein 14B antibody
    see all

Images

  • Anti-TMEM14B antibody (ab193198) at 2 µg/ml + K562 whole cell lysate

    Secondary
    Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 12 kDa
    Observed band size: 12 kDa

References

ab193198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up