
  • Product nameAnti-TMEM168 antibody
  • Description
    Rabbit polyclonal to TMEM168
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 576-625 (DIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSD Y) of Human TMEM168 (NP_ 071929).

  • Positive control
    • MCF7 cell lysate.



Our Abpromise guarantee covers the use of ab81360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.


Anti-TMEM168 antibody images

  • Anti-TMEM168 antibody (ab81360) at 1 µg/ml + MCF7 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 80 kDa
    Observed band size : >90 kDa (why is the actual band size different from the predicted?)

References for Anti-TMEM168 antibody (ab81360)

ab81360 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81360.
Please use the links above to contact us or submit feedback about this product.