Overview

  • Product nameAnti-TMEM176A antibody
    See all TMEM176A primary antibodies
  • Description
    Rabbit polyclonal to TMEM176A
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (

    GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ

    ) of Human TMEM176A (NP_060957).

  • Positive control
    • Human fetal stomach cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-TMEM176A antibody images

  • Anti-TMEM176A antibody (ab98935) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size : 26 kDa

References for Anti-TMEM176A antibody (ab98935)

ab98935 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"