Overview

  • Product nameAnti-TMEM19 antibody
  • Description
    Rabbit polyclonal to TMEM19
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: YTGLDESTGMVVNSPTNKARHIAGKPILDN, corresponding to amino acids 281-310 of Human TMEM19.

  • Positive control
    • Human kidney tissue; RT 4, U 51 MG and Human tonsil lysates.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab121516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.

Target

Anti-TMEM19 antibody images

  • ab121516 at 1/30 dilution, staining TMEM19 in paraffin-embedded distal tubular cells of Human kidney tissue by Immunohistochemistry.
  • All lanes : Anti-TMEM19 antibody (ab121516) at 1/250 dilution

    Lane 1 : RT 4 lysate
    Lane 2 : U 251 MG lysate
    Lane 3 : Human Plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

References for Anti-TMEM19 antibody (ab121516)

ab121516 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab121516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"