
  • Product nameAnti-TMEM195 antibody
    See all TMEM195 primary antibodies
  • Description
    Rabbit polyclonal to TMEM195
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRL P) of Human TMEM195 (NP_001004320).

  • Positive control
    • MCF7 cell lysate.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products


Our Abpromise guarantee covers the use of ab83030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 52 kDa (predicted molecular weight: 52 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.


Anti-TMEM195 antibody images

  • Anti-TMEM195 antibody (ab83030) at 1 µg/ml (5% skim milk / PBS ) + MCF7 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa
    Observed band size : 52 kDa

References for Anti-TMEM195 antibody (ab83030)

ab83030 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83030.
Please use the links above to contact us or submit feedback about this product.