Overview

  • Product name
  • Description
    Rabbit polyclonal to TMEM2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide corresponding to Mouse TMEM2 aa 1-50 (N terminal).
    Sequence:

    MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLT

  • Positive control
    • Mouse liver lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab116235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 154 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-TMEM2 antibody images

  • Anti-TMEM2 antibody (ab116235) at 1 µg/ml + Mouse liver lysate at 10 µg

    Predicted band size : 154 kDa

References for Anti-TMEM2 antibody (ab116235)

ab116235 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up