Overview

  • Product nameAnti-TMEM63C antibody
  • Description
    Rabbit polyclonal to TMEM63C
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 720 - 769 (

    EEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMN

    ) of Human TMEM63C (NP_065164).

  • Positive control
    • THP-1 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab90266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 93 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceTMEM63C belongs to the SPO75/TMEM63 family. The specific function of the protein remains unknown.
  • Cellular localizationMembrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • 4932420N09 antibody
    • 9330187M14Rik antibody
    • C14orf171 antibody
    • Chromosome 14 open reading frame 171 antibody
    • DKFZp434P0111 antibody
    • RGD1310207 antibody
    • Transmembrane protein 63c antibody
    see all

Anti-TMEM63C antibody images

  • Anti-TMEM63C antibody (ab90266) at 1 µg/ml + THP-1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 93 kDa

References for Anti-TMEM63C antibody (ab90266)

ab90266 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"