Overview

  • Product name
  • Description
    Rabbit polyclonal to TMEM63C
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 720 - 769 (

    EEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMN

    ) of Human TMEM63C (NP_065164).

  • Positive control
    • THP-1 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 93 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    TMEM63C belongs to the SPO75/TMEM63 family. The specific function of the protein remains unknown.
  • Cellular localization
    Membrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • 4932420N09 antibody
    • 9330187M14Rik antibody
    • C14orf171 antibody
    • Calcium permeable stress gated cation channel 1 homolog antibody
    • Chromosome 14 open reading frame 171 antibody
    • CSC1 antibody
    • DKFZp434P0111 antibody
    • hsCSC1 antibody
    • RGD1310207 antibody
    • Transmembrane protein 63c antibody
    see all

Images

  • Anti-TMEM63C antibody (ab90266) at 1 µg/ml + THP-1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 93 kDa

References

ab90266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up