Overview

  • Product nameAnti-TMEM69 antibody
  • Description
    Rabbit polyclonal to TMEM69
  • Tested applicationsSuitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 131-180 (

    AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE

    ) of Human TMEM69 (NP_057570).

  • Positive control
    • HepG2 cell lysate and Human kidney tissue.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab105677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 28 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Anti-TMEM69 antibody images

  • Anti-TMEM69 antibody (ab105677) at 0.5 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 28 kDa
  • Immunohistochemical analysis of TMEM69 expression in paraffin embedded Human kidney section using 8 µg/ml ab105677. Please note: arrows indicate positively labelled epithelial cells of renal tubule.

References for Anti-TMEM69 antibody (ab105677)

ab105677 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"