Overview

  • Product nameAnti-TNFAIP8L1 antibody
  • Description
    Rabbit polyclonal to TNFAIP8L1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 136-185 (AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGS L) of human TNFAIP8L1 (NP_689575)

  • Positive control
    • HepG2 Cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 mg/ml. Predicted molecular weight: 21 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-TNFAIP8L1 antibody images

  • Anti-TNFAIP8L1 antibody (ab85409) at 1 µg/ml + HepG2 Cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size : 21 kDa
    Observed band size : <22 kDa (why is the actual band size different from the predicted?)

References for Anti-TNFAIP8L1 antibody (ab85409)

ab85409 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"