Overview

  • Product name
    Anti-TNFRSF19 antibody
  • Description
    Mouse Polyclonal to TNFRSF19
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human TNFRSF19 aa 1-417. (NP_683760.1)
    Sequence:

    MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCN QCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNR FQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCA SKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK KPSWSLRSQDIQYNGSELSCFDRPQLHEYAHRACCQCRRDSVQTCGPVRL LPSMCCEEACSPNPATLGCGVHSAASLQARNAGPAGEMVPTFFGSLTQSI CGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSN SSQDLVGGAVPVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQ ESGAVIHPATQTSLQEA


    Database link: Q9NS68-2

  • Positive control
    • TNFRSF19 transfected 293T cell line.

Properties

Applications

Our Abpromise guarantee covers the use of ab172781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Relevance
    TNFRSF19 is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
  • Cellular localization
    Cell Membrane. Single-pass type I membrane protein.
  • Database links
  • Alternative names
    • TAJ alpha antibody
    • TAJ antibody
    • TNFRSF 19 antibody
    • Toxicity and JNK inducer antibody
    • TRADE antibody
    • TROY antibody
    • Tumor necrosis factor receptor superfamily member 19 antibody
    see all

Images

  • All lanes : Anti-TNFRSF19 antibody (ab172781) at 1 µg/ml

    Lane 1 : TNFRSF19 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 45 kDa

References

ab172781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up