Overview

  • Product name
    Anti-TNNI1 antibody [AT36E7]
    See all TNNI1 primary antibodies
  • Description
    Mouse monoclonal [AT36E7] to TNNI1
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit
  • Immunogen

    Recombinant full length protein corresponding to Human TNNI1 aa 1-187. Expressed in E.coli.
    Sequence:

    MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIP TLQTRGLSLSALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLK VMDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRANLKSVKKEDT EKERPVEVGDWRKNVEAMSGMEGRKKMFDA AKSPTSQ


    Database link: P19237

  • Positive control
    • Mouse muscle lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.01% Sodium azide
    Constituents: 10% Glycerol, 89% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    AT36E7
  • Isotype
    IgG2b
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171650 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 22 kDa.
ELISA 1/500 - 1/5000.

Target

  • Function
    Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
  • Tissue specificity
    Highest levels observed in human skeletal muscle (e.g. gastrocnemious muscle), differentiated cultures of primary human muscle cells and rhabdomyosarcoma cells cultured in low serum medium. Expressed in C2 muscle cell myoblasts and myotubes.
  • Sequence similarities
    Belongs to the troponin I family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2700018B22Rik antibody
    • AI747285 antibody
    • DKFZp451O223 antibody
    • si:dz182n13.3 antibody
    • slow skeletal muscle antibody
    • slow-twitch isoform antibody
    • SSTNI antibody
    • TNN1 antibody
    • Tnni1 antibody
    • TNNI1_HUMAN antibody
    • Troponin I antibody
    • Troponin I slow skeletal muscle antibody
    • Troponin I slow twitch isoform antibody
    • troponin I type 1 (skeletal, slow) antibody
    • Troponin I, slow isoform antibody
    see all

Images

  • Lane 1 : Anti-TNNI1 antibody [AT36E7] (ab171650) at 1/500 dilution
    Lane 2 : Anti-TNNI1 antibody [AT36E7] (ab171650) at 1/1000 dilution
    Lane 3 : Anti-TNNI1 antibody [AT36E7] (ab171650) at 1/5000 dilution

    Lane 1 : Mouse muscle lysate
    Lane 2 : Mouse muscle lysate
    Lane 3 : Mouse muscle lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    Goat anti-mouse conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 22 kDa

References

ab171650 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171650.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up