Overview

  • Product name
  • Description
    Rabbit polyclonal to TOM1L2
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 394-457 (

    SLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLR TDLKGDDLEEGVTS

    ) of Human TOM1L2.

  • Positive control
    • A549, HeLa, Jurkat and NT2D1 cells

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 10% Glycerol, 0.1M Tris, 0.1M Glycine, pH 7.0
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab96320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 56 kDa.
IP Use a concentration of 5 µg/ml.

Target

  • Function
    Probable role in protein transport. May regulate growth factor-induced mitogenic signaling.
  • Tissue specificity
    Ubiquitously expressed with higher expression in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the TOM1 family.
    Contains 1 GAT domain.
    Contains 1 VHS domain.
  • Domain
    The GAT domain mediates interaction with TOLLIP.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ32746 antibody
    • Srebf1 antibody
    • Target of Myb-like protein 2 antibody
    • Target of myb1 like 2 antibody
    • Target of myb1-like 2 (chicken) antibody
    • TM1L2_HUMAN antibody
    • TOM1 antibody
    • TOM1-like 2 antibody
    • TOM1-like protein 2 antibody
    • TOM1L 2 antibody
    • Tom1l2 antibody
    see all

Anti-TOM1L2 antibody images

  • TOM1L2 was immunoprecipitated using 0.5mg Jurkat whole cell extract, 5µg of Rabbit polyclonal to TOM1L2 and 50µl of protein G magnetic beads (+). No antibody was added to the control (-).

    The antibody was incubated under agitation with Protein G beads for 10min, Jurkat whole cell extract lysate diluted in RIPA buffer was added to each sample and incubated for a further 10min under agitation.

    Proteins were eluted by addition of 40µl SDS loading buffer and incubated for 10min at 70°C; 10µl of each sample was separated on a SDS PAGE gel, transferred to a nitrocellulose membrane, blocked with 5% BSA and probed with ab96320.

    Secondary: Mouse monoclonal [SB62a] Secondary Antibody to Rabbit IgG light chain (HRP) (ab99697)

    >Band: 56kDa; TOM1L2

  • All lanes : Anti-TOM1L2 antibody (ab96320) at 1/1000 dilution

    Lane 1 : Jurkat whole cell lysate
    Lane 2 : NT2D1 whole cell lysate

    Lysates/proteins at 30 µg per lane.


    Predicted band size : 56 kDa
    7.5% SDS PAGE

References for Anti-TOM1L2 antibody (ab96320)

This product has been referenced in:
  • Masters TA  et al. MYO6 Regulates Spatial Organization of Signaling Endosomes Driving AKT Activation and Actin Dynamics. Cell Rep 19:2088-2101 (2017). Read more (PubMed: 28591580) »
  • Arden SD  et al. Loss of cargo binding in the human myosin VI deafness mutant (R1166X) leads to increased actin filament binding. Biochem J 473:3307-19 (2016). WB . Read more (PubMed: 27474411) »

See all 3 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab96320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up