Overview

  • Product nameAnti-TOM1L2 antibody
    See all TOM1L2 primary antibodies
  • Description
    Rabbit polyclonal to TOM1L2
  • Tested applicationsSuitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 394-457 (

    SLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLR TDLKGDDLEEGVTS

    ) of Human TOM1L2.

  • Positive control
    • A549, HeLa, Jurkat and NT2D1 cells

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: 0.01% Thimerosal (merthiolate)
    Constituents: 10% Glycerol, 0.1M Tris, 0.1M Glycine, pH 7.0
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab96320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 56 kDa.
IP Use a concentration of 5 µg/ml.

Target

  • FunctionProbable role in protein transport. May regulate growth factor-induced mitogenic signaling.
  • Tissue specificityUbiquitously expressed with higher expression in heart and skeletal muscle.
  • Sequence similaritiesBelongs to the TOM1 family.
    Contains 1 GAT domain.
    Contains 1 VHS domain.
  • DomainThe GAT domain mediates interaction with TOLLIP.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ32746 antibody
    • Srebf1 antibody
    • Target of Myb-like protein 2 antibody
    • Target of myb1 like 2 antibody
    • Target of myb1-like 2 (chicken) antibody
    • TM1L2_HUMAN antibody
    • TOM1 antibody
    • TOM1-like 2 antibody
    • TOM1-like protein 2 antibody
    • TOM1L 2 antibody
    • Tom1l2 antibody
    see all

Anti-TOM1L2 antibody images

  • TOM1L2 was immunoprecipitated using 0.5mg Jurkat whole cell extract, 5µg of Rabbit polyclonal to TOM1L2 and 50µl of protein G magnetic beads (+). No antibody was added to the control (-).

    The antibody was incubated under agitation with Protein G beads for 10min, Jurkat whole cell extract lysate diluted in RIPA buffer was added to each sample and incubated for a further 10min under agitation.

    Proteins were eluted by addition of 40µl SDS loading buffer and incubated for 10min at 70°C; 10µl of each sample was separated on a SDS PAGE gel, transferred to a nitrocellulose membrane, blocked with 5% BSA and probed with ab96320.

    Secondary: Mouse monoclonal [SB62a] Secondary Antibody to Rabbit IgG light chain (HRP) (ab99697)

    >Band: 56kDa; TOM1L2

  • All lanes : Anti-TOM1L2 antibody (ab96320) at 1/1000 dilution

    Lane 1 : Jurkat whole cell lysate
    Lane 2 : NT2D1 whole cell lysate

    Lysates/proteins at 30 µg per lane.


    Predicted band size : 56 kDa
    7.5% SDS PAGE

References for Anti-TOM1L2 antibody (ab96320)

This product has been referenced in:
  • Arden SD  et al. Loss of cargo binding in the human myosin VI deafness mutant (R1166X) leads to increased actin filament binding. Biochem J 473:3307-19 (2016). WB . Read more (PubMed: 27474411) »
  • Tumbarello DA  et al. The Autophagy Receptor TAX1BP1 and the Molecular Motor Myosin VI Are Required for Clearance of Salmonella Typhimurium by Autophagy. PLoS Pathog 11:e1005174 (2015). Read more (PubMed: 26451915) »

See all 2 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab96320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"