Anti-TOMM22/TOM22 antibody [4G4] (ab57523)
Key features and details
- Mouse monoclonal [4G4] to TOMM22/TOM22
- Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-TOMM22/TOM22 antibody [4G4]
See all TOMM22/TOM22 primary antibodies -
Description
Mouse monoclonal [4G4] to TOMM22/TOM22 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein (GST-tag) corresponding to Human TOMM22/TOM22 aa 1-142.
Sequence:MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWG LTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV FETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Database link: Q9NS69 -
Positive control
- IHC-P: Human small Intestine. ICC/IF: HeLa cell. WB: NIH/3T3 cell lysate. Flow cyt: HeLa cells.
-
General notes
This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
4G4 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab57523 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use at an assay dependent concentration. Predicted molecular weight: 15 kDa.
|
|
IHC-P |
Use at an assay dependent concentration.
|
|
Flow Cyt |
Use at an assay dependent concentration.
ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody. |
|
ICC/IF |
Use at an assay dependent concentration.
|
Notes |
---|
WB
Use at an assay dependent concentration. Predicted molecular weight: 15 kDa. |
IHC-P
Use at an assay dependent concentration. |
Flow Cyt
Use at an assay dependent concentration. ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody. |
ICC/IF
Use at an assay dependent concentration. |
Target
-
Cellular localization
Mitochondrion outer membrane; Single-pass membrane protein -
Database links
- Entrez Gene: 56993 Human
- Entrez Gene: 223696 Mouse
- Omim: 607046 Human
- SwissProt: Q9CPQ3 Mouse
-
Alternative names
- 1C9 2 antibody
- hTom 22 antibody
- hTom22 antibody
see all
Images
-
TOMM22/TOM22 antibody (ab57523) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human small Intestine.
This image was generated using the ascites version of the product.
-
TOMM22/TOM22 antibody (ab57523) at 1ug/lane + NIH/3T3 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
Anti-TOMM22/TOM22 antibody [4G4] (ab57523) + immunogen peptide, Full length TOMM22 / TOM22 with GST tag.
Predicted band size: 15 kDaGST tag MW is 26kDa.
-
Immunocytochemistry/ Immunofluorescence of TOMM22 in HeLa cell using ab57523 at 10 μg/ml.
-
ICC/IF image of ab57523 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab57523, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
Overlay histogram showing HeLa cells stained with ab57523 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57523, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.
This image was generated using the ascites version of the product.
Protocols
Datasheets and documents
-
Datasheet download
References (13)
ab57523 has been referenced in 13 publications.
- Chatterjee S et al. The type III secretion system effector EspO of enterohaemorrhagic Escherichia coli inhibits apoptosis through an interaction with HAX-1. Cell Microbiol N/A:e13366 (2021). PubMed: 34021690
- Busch JD et al. MitoRibo-Tag Mice Provide a Tool for In Vivo Studies of Mitoribosome Composition. Cell Rep 29:1728-1738.e9 (2019). PubMed: 31693908
- Aghajani Nargesi A et al. Metabolic Syndrome Modulates Protein Import into the Mitochondria of Porcine Mesenchymal Stem Cells. Stem Cell Rev Rep 15:427-438 (2019). PubMed: 30338499
- Thai PN et al. Cardiac-specific Conditional Knockout of the 18-kDa Mitochondrial Translocator Protein Protects from Pressure Overload Induced Heart Failure. Sci Rep 8:16213 (2018). PubMed: 30385779
- Ni Z et al. AKT-mediated phosphorylation of ATG4B impairs mitochondrial activity and enhances the Warburg effect in hepatocellular carcinoma cells. Autophagy 14:685-701 (2018). PubMed: 29165041