Overview

  • Product name
    Anti-TPSB2 antibody (FITC)
    See all TPSB2 primary antibodies
  • Description
    Rabbit polyclonal to TPSB2 (FITC)
  • Host species
    Rabbit
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Mouse TPSB2 aa 32-276. Mature form.
    Sequence:

    IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHI KSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVP VNVSTHIHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKV PIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVC KVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHRYVPEHS


    Database link: P21845

Properties

Applications

Our Abpromise guarantee covers the use of ab193029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 31 kDa.

Target

  • Function
    Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. Has an immunoprotective role during bacterial infection. Required to efficiently combat K.pneumoniae infection.
  • Sequence similarities
    Belongs to the peptidase S1 family. Tryptase subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted. Released from the secretory granules upon mast cell activation.
  • Information by UniProt
  • Database links
  • Alternative names
    • Mast cell tryptase beta II antibody
    • Mast cell tryptase beta III antibody
    • TPS2 antibody
    • TPSB2 antibody
    • TRYB2_HUMAN antibody
    • Tryptase beta 2 (gene/pseudogene) antibody
    • Tryptase beta-2 antibody
    • Tryptase II antibody
    • Tryptase-2 antibody
    • TryptaseB antibody
    • TryptaseC antibody
    see all

References

ab193029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up