Overview

  • Product name
  • Description
    Mouse polyclonal to TRAF3
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human TRAF3 aa 1-568.
    Sequence:

    MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDK YKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKV FKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVR PDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCV VVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKA HEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSM KSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLA DMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYF GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD QGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIK DDTIFIKVIVDTSDLPDP


    Database link: NP_003291.2

  • Positive control
    • TRAF3-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 64 kDa.

Target

  • Function
    Regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of B cell survival. Part of signaling pathways leading to the production of cytokines and interferon. Required for normal antibody isotype switching from IgM to IgG. Plays a role T-cell dependent immune responses. Plays a role in the regulation of antiviral responses. Is an essential constituent of several E3 ubiquitin-protein ligase complexes. May have E3 ubiquitin-protein ligase activity and promote 'Lys-63'-linked ubiquitination of target proteins. Inhibits activation of NF-kappa-B in response to LTBR stimulation. Inhibits TRAF2-mediated activation of NF-kappa-B. Down-regulates proteolytic processing of NFKB2, and thereby inhibits non-canonical activation of NF-kappa-B. Promotes ubiquitination and proteasomal degradation of MAP3K14.
  • Sequence similarities
    Belongs to the TNF receptor-associated factor family. A subfamily.
    Contains 1 MATH domain.
    Contains 1 RING-type zinc finger.
    Contains 2 TRAF-type zinc fingers.
  • Domain
    The MATH/TRAF domain binds to receptor cytoplasmic domains.
    The Ring-type zinc finger domain is required for its function in down-regulation of NFKB2 proteolytic processing.
  • Post-translational
    modifications
    Undergoes 'Lys-48'-linked polyubiquitination, leading to its proteasomal degradation in response to signaling by TNFSF13B, TLR4 or through CD40. Undergoes 'Lys-63'-linked ubiquitination during early stages of virus infection, and 'Lys-48'-linked ubiquitination during later stages. Undergoes both 'Lys-48'-linked and 'Lys-63'-linked ubiquitination in response to TLR3 and TLR4 signaling (By similarity). Deubiquitinated by OTUB1, OTUB2 and OTUD5.
  • Cellular localization
    Cytoplasm. Endosome. Mitochondrion. Undergoes endocytosis together with TLR4 upon LPS signaling (By similarity). Associated with mitochondria in response to virus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAP 1 antibody
    • CAP-1 antibody
    • CAP1 antibody
    • CD40 associated protein 1 antibody
    • CD40 binding protein antibody
    • CD40 bp antibody
    • CD40 receptor associated factor 1 antibody
    • CD40 receptor-associated factor 1 antibody
    • CD40-binding protein antibody
    • CD40BP antibody
    • CRAF 1 antibody
    • CRAF1 antibody
    • IIAE5 antibody
    • LAP 1 antibody
    • LAP1 antibody
    • LMP1 associated protein antibody
    • LMP1-associated protein 1 antibody
    • MIPT3 antibody
    • TNF receptor associated factor 3 antibody
    • TNF receptor-associated factor 3 antibody
    • TRAF 3 antibody
    • Traf3 antibody
    • TRAF3_HUMAN antibody
    see all

Images

  • All lanes : Anti-TRAF3 antibody (ab172240) at 1 µg/ml

    Lane 1 : TRAF3-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 64 kDa

References

ab172240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up