Overview

  • Product name
    Anti-TRAF5 antibody [55A219]
    See all TRAF5 primary antibodies
  • Description
    Mouse monoclonal [55A219] to TRAF5
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human TRAF5 aa 77-186 (internal sequence).
    Sequence:

    TVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQ DHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVV VINLQNHEEN

  • Positive control
    • Human kidney tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    Preservative: 0.02% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Clonality
    Monoclonal
  • Clone number
    55A219
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab115589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 64 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Adapter protein and signal transducer that links members of the tumor necrosis factor receptor family to different signaling pathways by association with the receptor cytoplasmic domain and kinases. Mediates activation of NF-kappa-B and probably JNK. Seems to be involved in apoptosis.
  • Tissue specificity
    Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and peripheral blood.
  • Sequence similarities
    Belongs to the TNF receptor-associated factor family. A subfamily.
    Contains 1 MATH domain.
    Contains 1 RING-type zinc finger.
    Contains 2 TRAF-type zinc fingers.
  • Domain
    The MATH/TRAF domain binds to receptor cytoplasmic domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC:39780 antibody
    • RING finger protein 84 antibody
    • RNF 84 antibody
    • RNF84 antibody
    • TNF receptor associated factor 5 antibody
    • TNF receptor-associated factor 5 antibody
    • TRAF 5 antibody
    • Traf5 antibody
    • TRAF5_HUMAN antibody
    see all

Images

  • ab115589, at 10 µg/ml, staining TRAF5 in formalin fixed, paraffin embedded Human kidney tissue by Immunohistochemistry. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen.

References

This product has been referenced in:
  • Siriboon C  et al. Putative porcine embryonic stem cell lines derived from aggregated four-celled cloned embryos produced by oocyte bisection cloning. PLoS One 10:e0118165 (2015). Read more (PubMed: 25680105) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up