Overview

  • Product nameAnti-TRAF5 antibody [55A219]
    See all TRAF5 primary antibodies
  • Description
    Mouse monoclonal [55A219] to TRAF5
  • Tested applicationsSuitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human TRAF5 aa 77-186 (internal sequence).
    Sequence:

    TVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQ DHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVV VINLQNHEEN

  • Positive control
    • Human kidney tissue

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferPreservative: 0.02% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • PurityProtein G purified
  • ClonalityMonoclonal
  • Clone number55A219
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab115589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 64 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • FunctionAdapter protein and signal transducer that links members of the tumor necrosis factor receptor family to different signaling pathways by association with the receptor cytoplasmic domain and kinases. Mediates activation of NF-kappa-B and probably JNK. Seems to be involved in apoptosis.
  • Tissue specificityExpressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and peripheral blood.
  • Sequence similaritiesBelongs to the TNF receptor-associated factor family. A subfamily.
    Contains 1 MATH domain.
    Contains 1 RING-type zinc finger.
    Contains 2 TRAF-type zinc fingers.
  • DomainThe MATH/TRAF domain binds to receptor cytoplasmic domains.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC:39780 antibody
    • RING finger protein 84 antibody
    • RNF 84 antibody
    • RNF84 antibody
    • TNF receptor associated factor 5 antibody
    • TNF receptor-associated factor 5 antibody
    • TRAF 5 antibody
    • Traf5 antibody
    • TRAF5_HUMAN antibody
    see all

Anti-TRAF5 antibody [55A219] images

  • ab115589, at 10 µg/ml, staining TRAF5 in formalin fixed, paraffin embedded Human kidney tissue by Immunohistochemistry. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen.

References for Anti-TRAF5 antibody [55A219] (ab115589)

ab115589 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"