Overview

  • Product nameAnti-TRAF6BP antibody
    See all TRAF6BP primary antibodies
  • Description
    Rabbit polyclonal to TRAF6BP
  • Tested applicationsSuitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to Human TRAF6BP.
    Sequence:

    DQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD

  • Positive control
    • Raji cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage bufferPreservative: 0.05% Sodium Azide
    Constituents: 0.05% BSA, PBS
  • Concentration information loading...
  • PurityProtein G purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Detects a band of approximately 86 kDa.
IP Use at an assay dependent dilution.

Target

  • FunctionInhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade.
  • Tissue specificityExpressed in all tissues tested.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1200003J11Rik antibody
    • 1700069J21Rik antibody
    • Aa1076 antibody
    • AA930106 antibody
    • CALCOCO 3 antibody
    • CALCOCO3 antibody
    • D6Ertd404e antibody
    • D6Ertd772e antibody
    • Human T cell leukemia virus type 1-binding protein antibody
    • Liver regeneration-related protein LRRG004 antibody
    • MGC94031 antibody
    • PRO0105 antibody
    • T6BP antibody
    • Tax1 (human T cell leukemia virus type I) binding protein antibody
    • Tax1 (human T cell leukemia virus type I) binding protein 1 antibody
    • Tax1 binding protein 1 antibody
    • Tax1 binding protein antibody
    • Tax1-binding protein 1 antibody
    • Tax1-binding protein 1 homolog antibody
    • TAX1BP1 antibody
    • TAX1BP1 protein antibody
    • tax1bp1b antibody
    • TAXB1_HUMAN antibody
    • TRAF 6 binding protein antibody
    • TRAF6 binding protein antibody
    • TRAF6 binding protein T6BP antibody
    • TRAF6-binding protein antibody
    • TRAF6-interacting protein antibody
    • TXBP 151 antibody
    • TXBP151 antibody
    • wu:fc20c12 antibody
    • wu:fc56e11 antibody
    • zgc:73219 antibody
    • zgc:77129 antibody
    see all

Anti-TRAF6BP antibody images

  • Anti-TRAF6BP antibody (ab22049) at 2 µg/ml + Raji cell lysate at 20 µg

    Observed band size : 86 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 110 kDa,16 kDa,42 kDa,64 kDa,70 kDa. We are unsure as to the identity of these extra bands.

References for Anti-TRAF6BP antibody (ab22049)

This product has been referenced in:
  • Charoenthongtrakul S  et al. RING finger protein 11 targets TBK1/IKKi kinases to inhibit antiviral signaling. PLoS One 8:e53717 (2013). WB . Read more (PubMed: 23308279) »
  • Nakano S  et al. Commensal Microbiota Contributes to Chronic Endocarditis in TAX1BP1 Deficient Mice. PLoS One 8:e73205 (2013). IHC ; Mouse . Read more (PubMed: 24086273) »

See all 7 Publications for this product

Product Wall

Abreviews
Application Western blot
Sample Mouse Cell lysate - whole cell (Hela human MDM RAW 264.7)
Gel Running Conditions Reduced Denaturing (4-12% gel)
Loading amount 50 µg
Specification Hela human MDM RAW 264.7
Blocking step Odyssey Blocking TBST as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 50% · Temperature: 20°C
Username

Abcam user community

Verified customer

Submitted Jun 24 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"