Overview

  • Product name
    Anti-Transaldolase 1 antibody
    See all Transaldolase 1 primary antibodies
  • Description
    Rabbit polyclonal to Transaldolase 1
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Synthetic peptide within Human Transaldolase 1 aa 267-317. The exact sequence is proprietary.
    Sequence:

    NAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFA A


    Database link: P37837

  • Positive control
    • HeLa, Jurkat, 293, NIH 3T3 and TCMK-1 cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab187730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/1000 - 1/5000. Predicted molecular weight: 37 kDa.

Target

  • Function
    Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
  • Pathway
    Carbohydrate degradation; pentose phosphate pathway; D-glyceraldehyde 3-phosphate and beta-D-fructose 6-phosphate from D-ribose 5-phosphate and D-xylulose 5-phosphate (non-oxidative stage): step 2/3.
  • Involvement in disease
    Defects in TALDO1 are the cause of transaldolase 1 deficiency (TALDO1 deficiency) [MIM:606003]. It results in telangiectases of the skin, hepatosplenomegaly, and enlarged clitoris.
  • Sequence similarities
    Belongs to the transaldolase family. Type 1 subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dihydroxyacetone transferase antibody
    • EC 2.2.1.2 antibody
    • EPS8L2 antibody
    • Glycerone transferase antibody
    • TAL antibody
    • TAL H antibody
    • TALDO antibody
    • TALDO_HUMAN antibody
    • TALDO1 antibody
    • TALDOR antibody
    • TALH antibody
    • Transaldolase 1 antibody
    • Transaldolase antibody
    see all

Images

  • All lanes : Anti-Transaldolase 1 antibody (ab187730) at 0.4 µg/ml

    Lane 1 : HeLa cell lysate
    Lane 2 : 293T cell lysate
    Lane 3 : Jurkat cell lysate
    Lane 4 : Mouse TCMK-1 cell lysate
    Lane 5 : Mouse NIH 3T3 cell lysate

    Lysates/proteins at 50 µg per lane.


    Predicted band size : 37 kDa
  • Immunoprecipitation of Transaldolase 1 from HeLa whole cell lysate (1 mg per lane), using ab187730 at 6 µg (lane 1) or an IgG control (lane 2). For western blot of immunoprecipitated protein, ab187730 was used at 1 µg/ml.

    Detection: ECL with an exposure time of 30 seconds.

References

ab187730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up