Anti-Transferrin Receptor 2 antibody (ab84287)


  • Product nameAnti-Transferrin Receptor 2 antibody
    See all Transferrin Receptor 2 primary antibodies
  • Description
    Rabbit polyclonal to Transferrin Receptor 2
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 179 - 228 (RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLED P) of Human Transferrin Receptor 2 (NP_003218)

  • Positive control
    • Human Fetal muscle lysate



Our Abpromise guarantee covers the use of ab84287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 89 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionMediates cellular uptake of transferrin-bound iron in a non-iron dependent manner. May be involved in iron metabolism, hepatocyte function and erythrocyte differentiation.
  • Tissue specificityPredominantly expressed in liver. While the alpha form is also expressed in spleen, lung, muscle, prostate and peripheral blood mononuclear cells, the beta form is expressed in all tissues tested, albeit weakly.
  • Involvement in diseaseDefects in TFR2 are a cause of hemochromatosis type 3 (HFE3) [MIM:604250]. HFE3 is a disorder of iron hemostasis resulting in iron overload and has a phenotype indistinguishable from that of hereditary hemochromatosis (HH). HH is characterized by abnormal intestinal iron absorption and progressive increase of total body iron, which results in midlife in clinical complications including cirrhosis, cardiopathy, diabetes, endocrine dysfunctions, arthropathy, and susceptibility to liver cancer. Since the disease complications can be effectively prevented by regular phlebotomies, early diagnosis is most important to provide a normal life expectancy to the affected subjects.
  • Sequence similaritiesBelongs to the peptidase M28 family. M28B subfamily.
  • Cellular localizationCell membrane and Cytoplasm. Lacks the transmembrane domain. Probably intracellular.
  • Information by UniProt
  • Database links
  • Alternative names
    • HFE 3 antibody
    • HFE3 antibody
    • MGC126368 antibody
    • TFR 2 antibody
    • TfR2 antibody
    • TFR2_HUMAN antibody
    • TFRC 2 antibody
    • TFRC2 antibody
    • Transferrin receptor 2 antibody
    • Transferrin receptor protein 2 antibody
    see all

Anti-Transferrin Receptor 2 antibody images

  • Anti-Transferrin Receptor 2 antibody (ab84287) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal muscle lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 89 kDa
    Observed band size : 89 kDa
  • IHC image of ab84287 staining in human normal liver formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with EDTA (pH9, epitope retrieval solution 2) for 20 mins. The section was then incubated with ab84287, 1µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skin tissue labelling Transferrin Receptor 2 with ab84287 at 4-8µg/ml.

References for Anti-Transferrin Receptor 2 antibody (ab84287)

ab84287 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84287.
Please use the links above to contact us or submit feedback about this product.