Anti-Transferrin Receptor antibody (ab193188)

Overview

  • Product name
    Anti-Transferrin Receptor antibody
    See all Transferrin Receptor primary antibodies
  • Description
    Rabbit polyclonal to Transferrin Receptor
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ELISA, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Transferrin Receptor aa 94-754.
    Sequence:

    PKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGT IKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVK DSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDF EDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNA ELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAE KLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVI KGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQ PSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSN FKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFP FLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEV AGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLY SARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPK ESPFRHVFWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQ GAANALSGDV W


    Database link: P02786

  • Positive control
    • WB: U251, 293T and Jurkat whole cell lysates. IHC-P: Human placenta and human colon cancer tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab193188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 85 kDa (predicted molecular weight: 85 kDa).
IHC-P 1/20 - 1/200.
ELISA Use at an assay dependent concentration.
ICC/IF 1/50 - 1/200.

Target

  • Function
    Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system (By similarity). A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake (PubMed:26642240).
    (Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus.
  • Involvement in disease
    Immunodeficiency 46
  • Sequence similarities
    Belongs to the peptidase M28 family. M28B subfamily.
    Contains 1 PA (protease associated) domain.
  • Post-translational
    modifications
    N- and O-glycosylated, phosphorylated and palmitoylated. The serum form is only glycosylated.
    Proteolytically cleaved on Arg-100 to produce the soluble serum form (sTfR).
    Palmitoylated on both Cys-62 and Cys-67. Cys-62 seems to be the major site of palmitoylation.
  • Cellular localization
    Secreted and Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD 71 antibody
    • CD71 antibody
    • CD71 antigen antibody
    • IMD46 antibody
    • OTTHUMP00000208523 antibody
    • OTTHUMP00000208524 antibody
    • OTTHUMP00000208525 antibody
    • p90 antibody
    • sTfR antibody
    • T9 antibody
    • TFR 1 antibody
    • TfR antibody
    • TfR1 antibody
    • TFR1_HUMAN antibody
    • TFRC antibody
    • TR antibody
    • Transferrin receptor (p90 CD71) antibody
    • Transferrin receptor protein 1, serum form antibody
    • Trfr antibody
    see all

Images

  • All lanes : Anti-Transferrin Receptor antibody (ab193188) at 2 µg/ml

    Lane 1 : U251 whole cell lysate
    Lane 2 : 293T whole cell lysate

    Secondary
    All lanes : Polyclonal goat anti-rabbit at 1/10000 dilution

    Predicted band size: 85 kDa
    Observed band size: 85 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling Transferrin Receptor with ab193188 at a dilution of 1/100.

  • Anti-Transferrin Receptor antibody (ab193188) at 3 µg/ml + Jurkat whole cell lysate

    Secondary
    Polyclonal goat anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 85 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human colon cancer tissue labelling Transferrin Receptor with ab193188 at a dilution of 1/100.

  • Immunocytochemistry/Immunofluorescence analysis of HepG2 cells labelling Transferrin Receptor with ab193188 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

References

ab193188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up