Overview

  • Product nameAnti-Transglutaminase 3 antibody
    See all Transglutaminase 3 primary antibodies
  • Description
    Rabbit polyclonal to Transglutaminase 3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Dog
  • Immunogen

    Synthetic peptide corresponding to N terminal amino acids 1-50 (

    MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS

    ) of Human Transglutaminase 3 (NP_003236)

  • Positive control
    • PANC1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab97954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 77 kDa.
Note: Optimal concentration of antibody depends the protein level in a given sample. Our recommended concentrations are the starting point for general use. Customers are advised have to do a series of titration tests to determine optimal concentration.

Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalyzes the calcium-dependent formation of isopeptide cross-links between glutamine and lysine residues in various proteins, as well as the conjugation of polyamines to proteins. Involved in the formation of the cornified envelope (CE), a specialized component consisting of covalent cross-links of proteins beneath the plasma membrane of terminally differentiated keratinocytes. Catalyzes small proline-rich proteins (SPRR1 and SPRR2) and LOR cross-linking to form small interchain oligomers, which are further cross-linked by TGM1 onto the growing CE scaffold (By similarity). In hair follicles, involved in cross-linking structural proteins to hardening the inner root sheath.
  • Sequence similaritiesBelongs to the transglutaminase superfamily. Transglutaminase family.
  • Post-translational
    modifications
    Activated by proteolytic processing. In vitro activation is commonly achieved by cleavage with dispase, a neutral bacterial protease. Dispase cleavage site was proposed to lie between Ser-470 and Ser-471 (PubMed:8099584) or between Pro-465 and Phe-466 (PubMed:16565075). Physiological activation may be catalyzed by CTSL and, to a lesser extent, by CTSS, but not by CTSB, CTSD nor CTSV (PubMed:16565075).
  • Information by UniProt
  • Database links
  • Alternative names
    • E polypeptide protein glutamine gamma glutamyltransferase antibody
    • MGC126249 antibody
    • MGC126250 antibody
    • Protein glutamine gamma glutamyltransferase E 27 kDa catalytic chain antibody
    • Protein glutamine gamma glutamyltransferase E 50 kDa noncatalytic chain antibody
    • Protein glutamine gamma glutamyltransferase E antibody
    • Protein-glutamine gamma-glutamyltransferase E 27 kDa non-catalytic chain antibody
    • TG(E) antibody
    • TGase E antibody
    • TGase-3 antibody
    • TGE antibody
    • TGM 3 antibody
    • TGM3 antibody
    • TGM3_HUMAN antibody
    • Transglutaminase E antibody
    • Transglutaminase-3 antibody
    • Transglutaminase3 antibody
    • TransglutaminaseE antibody
    see all

Anti-Transglutaminase 3 antibody images

  • Anti-Transglutaminase 3 antibody (ab97954) at 1 µg/ml + PANC1 cell lysate at 10 µg with skim milk/ PBS buffer at 5 %

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 77 kDa

References for Anti-Transglutaminase 3 antibody (ab97954)

ab97954 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"