Overview

  • Product name
  • Description
    Rabbit polyclonal to TRAP100
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human TRAP100 aa 801-850. The exact sequence is proprietary. Synthetic peptide around Lys834 of Human TRAP100.
    Sequence:

    LMDPPGTALAKLAVWCALSSYSSHKGQASTRQKKRHREDIEDYISLFPLD


    Database link: O75448

  • Positive control
    • 293 cell extract; Human Brain, Cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab194951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB 1/500 - 1/1000.
ICC/IF 1/50 - 1/200.

Target

  • Function
    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Tissue specificity
    Ubiquitous. Abundant in skeletal muscle, heart and placenta.
  • Sequence similarities
    Belongs to the Mediator complex subunit 24 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CRSP complex subunit 4 antibody
    • Activator recruited cofactor 100 kDa component antibody
    • Activator-recruited cofactor 100 kDa component antibody
    • ARC100 antibody
    • Cofactor required for Sp1 transcriptional activation subunit 4 antibody
    • CRSP complex subunit 4 antibody
    • CRSP100 antibody
    • CRSP4 antibody
    • DRIP100 antibody
    • hTRAP100 antibody
    • KIAA0130 antibody
    • MED 24 antibody
    • MED24 antibody
    • MED24_HUMAN antibody
    • Mediator complex subunit 24 antibody
    • Mediator of RNA polymerase II transcription subunit 24 antibody
    • Mediator of RNA polymerase II transcription subunit 24 homolog antibody
    • MGC8748 antibody
    • OTTHUMP00000164458 antibody
    • OTTHUMP00000164460 antibody
    • THRAP4 antibody
    • Thyroid hormone receptor associated protein 4 antibody
    • Thyroid hormone receptor associated protein complex 100 kDa component antibody
    • Thyroid hormone receptor-associated protein 4 antibody
    • Thyroid hormone receptor-associated protein complex 100 kDa component antibody
    • Trap100 antibody
    • Trapp100 antibody
    • Vitamin D3 receptor interacting protein complex component DRIP100 antibody
    • Vitamin D3 receptor-interacting protein complex 100 kDa component antibody
    see all

Images

  • Anti-TRAP100 antibody (ab194951) at 1/500 dilution + 293 cell extract
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human Brain, Cortex tissue labeling TRAP100 with ab194951 at 5 µg/ml.

References

ab194951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up