Overview

  • Product nameAnti-TRAP100 antibody
    See all TRAP100 primary antibodies
  • Description
    Rabbit polyclonal to TRAP100
  • Tested applicationsSuitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human TRAP100 aa 939-989.
    Sequence:

    RGSVLQFMPFTTVSELVKVSAMSSPKVVLAITDLSLPLGRQVAAKAIAAL

  • Positive control
    • Whole cell lysate from MCF7, PANC1, 293T and HeLa cells and mouse NIH3T3 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab80468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 110 kDa.
IP Use at 2-5 µg/mg of lysate.

Target

  • FunctionComponent of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Tissue specificityUbiquitous. Abundant in skeletal muscle, heart and placenta.
  • Sequence similaritiesBelongs to the Mediator complex subunit 24 family.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CRSP complex subunit 4 antibody
    • Activator recruited cofactor 100 kDa component antibody
    • Activator-recruited cofactor 100 kDa component antibody
    • ARC100 antibody
    • Cofactor required for Sp1 transcriptional activation subunit 4 antibody
    • CRSP complex subunit 4 antibody
    • CRSP100 antibody
    • CRSP4 antibody
    • DRIP100 antibody
    • hTRAP100 antibody
    • KIAA0130 antibody
    • MED 24 antibody
    • MED24 antibody
    • MED24_HUMAN antibody
    • Mediator complex subunit 24 antibody
    • Mediator of RNA polymerase II transcription subunit 24 antibody
    • Mediator of RNA polymerase II transcription subunit 24 homolog antibody
    • MGC8748 antibody
    • OTTHUMP00000164458 antibody
    • OTTHUMP00000164460 antibody
    • THRAP4 antibody
    • Thyroid hormone receptor associated protein 4 antibody
    • Thyroid hormone receptor associated protein complex 100 kDa component antibody
    • Thyroid hormone receptor-associated protein 4 antibody
    • Thyroid hormone receptor-associated protein complex 100 kDa component antibody
    • Trap100 antibody
    • Trapp100 antibody
    • Vitamin D3 receptor interacting protein complex component DRIP100 antibody
    • Vitamin D3 receptor-interacting protein complex 100 kDa component antibody
    see all

References for Anti-TRAP100 antibody (ab80468)

ab80468 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab80468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"