Overview

  • Product name
    Anti-TRAPPC8 antibody
  • Description
    Rabbit polyclonal to TRAPPC8
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TRAPPC8 aa 111-204 (N terminal).
    Sequence:

    DYDLNISATTPWFESYRETFLQSMPASDHEFLNHYLACMLVASSSEAEPV EQFSKLSQEQHRIQHNSDYSYPKWFIPNTLKYYVLLHDVSAGDE


    Database link: Q9Y2L5

  • Positive control
    • Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab122692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use at an assay dependent concentration.

Target

  • Function
    May play a role in vesicular transport from endoplasmic reticulum to Golgi.
  • Sequence similarities
    Belongs to the TRS85 family.
  • Cellular localization
    Golgi apparatus > cis-Golgi network.
  • Information by UniProt
  • Database links
  • Alternative names
    • General sporulation gene 1 homolog antibody
    • GSG1 antibody
    • HsT2706 antibody
    • KIAA1012 antibody
    • Protein TRS85 homolog antibody
    • TPPC8_HUMAN antibody
    • Trafficking protein particle complex subunit 8 antibody
    • TRAPPC8 antibody
    • TRS85 antibody
    see all

Images

  • Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & microtubules.
  • ab122692, at 1/500 dilution, staining TRAPPC8 in paraffin-embedded Human testis tissue by Immunohistochemistry.

References

ab122692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Retina, Cryosections)
Antigen retrieval step
None
Permeabilization
Yes - 0,5% Triton-x-100
Specification
Retina, Cryosections
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Paraformaldehyde
Username

Lisa Janina Klotz

Verified customer

Submitted Mar 19 2018

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up