Overview

  • Product name
  • Description
    Rabbit polyclonal to TRIM43
  • Host species
    Rabbit
  • Tested applications
    Suitable for: Flow Cyt, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human TRIM43 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    QMRILWKKIQENQRNLYEEGRTAFLWRGNV


    Database link: Q96BQ3

  • Positive control
    • A549 cells and A549 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab170294 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/10 - 1/50.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

WB 1/100 - 1/500. Predicted molecular weight: 52 kDa.

Target

  • Relevance
    TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.
  • Database links
  • Alternative names
    • EG666731 antibody
    • Tripartite motif containing 43 antibody
    • Tripartite motif containing protein 43 antibody

Images

  • Flow cytometric analysis of A549 cells (right histogram) compared to a negative control cell (left histogram) labeling TRIM43 with ab10194 at 1/10 dilution. FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

  • Anti-TRIM43 antibody (ab170294) at 1/100 dilution + A549 cell lysate at 35 µg

    Predicted band size: 52 kDa

References

ab170294 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170294.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up