Overview

  • Product name
  • Description
    Rabbit polyclonal to TRIT1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 180 - 229 (

    HDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWL

    ) of Human TRIT1 (NP_060116)

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 of both cytosolic and mitochondrial tRNAs, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).
  • Sequence similarities
    Belongs to the IPP transferase family.
    Contains 1 matrin-type zinc finger.
  • Cellular localization
    Cytoplasm and Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2310075G14Rik antibody
    • AI314189 antibody
    • AI314635 antibody
    • AV099619 antibody
    • FLJ20061 antibody
    • hGRO1 antibody
    • IPP transferase antibody
    • IPPT antibody
    • IPT antibody
    • IPTase antibody
    • Isopentenyl diphosphate:tRNA isopentenyltransferase antibody
    • Isopentenyl-diphosphate:tRNA isopentenyltransferase antibody
    • MGC149242 antibody
    • MGC149243 antibody
    • mitochondrial antibody
    • MOD5 antibody
    • MOD5_HUMAN antibody
    • OTTMUSP00000009314 antibody
    • Putative protein TR2IT1 antibody
    • RP23-121J14.6 antibody
    • TRIT 1 antibody
    • TRIT1 antibody
    • tRNA dimethylallyltransferase antibody
    • tRNA isopentenylpyrophosphate transferase antibody
    • tRNA isopentenyltransferase 1 antibody
    • tRNA isopentenyltransferase antibody
    • tRNA isopentenyltransferase mitochondrial antibody
    see all

Images

  • Anti-TRIT1 antibody (ab87166) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 53 kDa

References

ab87166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up