Overview

  • Product name
  • Description
    Rabbit polyclonal to TRP1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Rat TRP1 aa 380-429 (C terminal).
    Sequence:

    AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN

  • Positive control
    • Rat brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. May regulate or influence the type of melanin synthesized.
  • Tissue specificity
    Pigment cells.
  • Pathway
    Pigment biosynthesis; melanin biosynthesis.
  • Involvement in disease
    Defects in TYRP1 are the cause of albinism oculocutaneous type 3 (OCA3) [MIM:203290]; also known as Rufous oculocutaneous albinism. An autosomal recessive disorder in which the biosynthesis of melanin pigment is reduced in skin, hair, and eyes. Tyrosinase activity is normal and patients have only moderate reduction of pigment. The eyes present red reflex on transillumination of the iris, dilution of color of iris, nystagmus and strabismus. Darker-skinned individuals have bright copper-red coloration of the skin and hair.
  • Sequence similarities
    Belongs to the tyrosinase family.
  • Cellular localization
    Melanosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 5 antibody
    • 5,6 dihydroxyindole 2 carboxylic acid oxidase antibody
    • 6-dihydroxyindole-2-carboxylic acid oxidase antibody
    • b-PROTEIN antibody
    • CAS2 antibody
    • Catalase B antibody
    • CATB antibody
    • DHICA oxidase antibody
    • Glycoprotein 75 antibody
    • GP75 antibody
    • Melanoma antigen gp75 antibody
    • OCA3 antibody
    • TRP antibody
    • TRP-1 antibody
    • TRP1 antibody
    • Tyrosinase related protein 1 antibody
    • Tyrosinase-related protein 1 antibody
    • TYRP antibody
    • TYRP1 antibody
    • TYRP1_HUMAN antibody
    • TYRRP antibody
    see all

Images

  • Anti-TRP1 antibody (ab113774) at 1 µg/ml + Rat brain lysate at 10 µg

    Predicted band size : 61 kDa
    Gel concentration: 12%

References

ab113774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up