Overview

  • Product nameAnti-TSH Receptor antibody
    See all TSH Receptor primary antibodies
  • Description
    Rabbit polyclonal to TSH Receptor
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Sheep, Horse, Cow, Cat, Dog, African Green Monkey
  • Immunogen

    Synthetic peptide within Human TSH Receptor aa 31-80. The exact sequence is proprietary.
    Sequence:

    CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR

  • Positive control
    • Jurkat

Properties

Applications

Our Abpromise guarantee covers the use of ab58917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Titre using peptide based assay, 1:312500.

WB Use a concentration of 1.25 µg/ml. Predicted molecular weight: 87 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionReceptor for thyrothropin. Plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Also acts as a receptor for thyrostimulin (GPA2+GPB5).
  • Tissue specificityExpressed in the thyroid.
  • Involvement in diseaseDefects in TSHR are found in patients affected by hyperthyroidism with different etiologies. Somatic, constitutively activating TSHR mutations and/or constitutively activating G(s)alpha mutations have been identified in toxic thyroid nodules (TTNs) that are the predominant cause of hyperthyroidism in iodine deficient areas. These mutations lead to TSH independent activation of the cAMP cascade resulting in thyroid growth and hormone production. TSHR mutations are found in autonomously functioning thyroid nodules (AFTN), toxic multinodular goiter (TMNG) and hyperfunctioning thyroid adenomas (HTA). TMNG encompasses a spectrum of different clinical entities, ranging from a single hyperfunctioning nodule within an enlarged thyroid, to multiple hyperfunctioning areas scattered throughout the gland. HTA are discrete encapsulated neoplasms characterized by TSH-independent autonomous growth, hypersecretion of thyroid hormones, and TSH suppression. Defects in TSHR are also a cause of thyroid neoplasms (papillary and follicular cancers).
    Autoantibodies against TSHR are directly responsible for the pathogenesis and hyperthyroidism of Graves disease. Antibody interaction with TSHR results in an uncontrolled receptor stimulation.
    Hypothyroidism, congenital, non-goitrous, 1
    Familial gestational hyperthyroidism
    Hyperthyroidism, non-autoimmune
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily.
    Contains 7 LRR (leucine-rich) repeats.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CHNG1 antibody
    • hTSHR I antibody
    • hTSHRI antibody
    • LGR 3 antibody
    • LGR3 antibody
    • MGC75129 antibody
    • Seven transmembrane helix receptor antibody
    • Thyroid adenoma hyperfunctioning antibody
    • Thyroid carcinoma with thyrotoxicosis antibody
    • Thyroid stimulating hormone receptor antibody
    • Thyroid stimulating hormone receptor, isoform 2 antibody
    • Thyroid-stimulating hormone receptor antibody
    • Thyrotropin receptor antibody
    • Thyrotropin receptor I antibody
    • Thyrotropin receptor I, hTSHR I antibody
    • TSH R antibody
    • TSH-R antibody
    • TSHR antibody
    • TSHR_HUMAN antibody
    see all

Anti-TSH Receptor antibody images

  • Anti-TSH Receptor antibody (ab58917) + Human Jurkat

    Predicted band size : 87 kDa
    Additional bands at : 21 kDa (possible isoform).
  • All lanes : Anti-TSH Receptor antibody (ab58917) at 2.5 µg/ml

    Lane 1 : Jurkat
    Lane 2 : Jurkat

    Lysates/proteins at 25 µg per lane.


    Predicted band size : 87 kDa
    Additional bands at : 21 kDa (possible isoform),48 kDa (possible isoform).

    Gel Concentration: 12%

References for Anti-TSH Receptor antibody (ab58917)

ab58917 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab58917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"