Overview

  • Product nameAnti-TSPYL6 antibody
    See all TSPYL6 primary antibodies
  • Description
    Rabbit polyclonal to TSPYL6
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 108-157 (

    DGSLKNGFPGEETHGLGGEKALETCGAGRSESEVIAEGKAEDVKPEECAM

    ) of Human TSPYL6 (NP_001003937).

  • Positive control
    • HT1080 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab89956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-TSPYL6 antibody images

  • Anti-TSPYL6 antibody (ab89956) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 46 kDa
    Observed band size : 46 kDa

References for Anti-TSPYL6 antibody (ab89956)

ab89956 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"