Overview

  • Product nameAnti-TSR1 antibody
  • Description
    Rabbit polyclonal to TSR1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 647-696 (MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKR V) of Human TSR1 (NP_060598)

  • Positive control
    • Fetal heart lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesab82982 is purified by a peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 92 kDa (predicted molecular weight: 92 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • RelevanceTSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.
  • Cellular localizationNucleus › nucleolus
  • Database links
  • Alternative names
    • AU040765 antibody
    • AW550801 antibody
    • FLJ10534 antibody
    • KIAA1401 antibody
    • MGC131829 antibody
    • mKIAA1401 antibody
    • OTTMUSP00000006478 antibody
    • Pre-rRNA-processing protein TSR1 homolog antibody
    • RP23-174M12.4 antibody
    • TSR1, 20S rRNA accumulation, homolog (S. cerevisiae) antibody
    see all

Anti-TSR1 antibody images

  • Anti-TSR1 antibody (ab82982) at 1 µg/ml + Fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 92 kDa
    Observed band size : 92 kDa

References for Anti-TSR1 antibody (ab82982)

ab82982 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"