Overview

  • Product name
  • Description
    Rabbit polyclonal to TSR1
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 647-696 (MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKR V) of Human TSR1 (NP_060598)

  • Positive control
    • Fetal heart lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab82982 is purified by a peptide affinity chromatography method.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 92 kDa (predicted molecular weight: 92 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Relevance
    TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.
  • Cellular localization
    Nucleus › nucleolus
  • Database links
  • Alternative names
    • AU040765 antibody
    • AW550801 antibody
    • FLJ10534 antibody
    • KIAA1401 antibody
    • MGC131829 antibody
    • mKIAA1401 antibody
    • OTTMUSP00000006478 antibody
    • Pre-rRNA-processing protein TSR1 homolog antibody
    • RP23-174M12.4 antibody
    • TSR1 ribosome maturation factor antibody
    • TSR1, 20S rRNA accumulation, homolog (S. cerevisiae) antibody
    see all

Images

  • Anti-TSR1 antibody (ab82982) at 1 µg/ml + Fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 92 kDa
    Observed band size : 92 kDa

References

ab82982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab82982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up