Anti-TTLL4 antibody - C-terminal (ab186045)

Overview

  • Product name
    Anti-TTLL4 antibody - C-terminal
    See all TTLL4 primary antibodies
  • Description
    Rabbit polyclonal to TTLL4 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Synthetic peptide within Human TTLL4 aa 1149-1199 (C terminal). The exact sequence is proprietary. NP_055455.3.
    Sequence:

    PSSSKDSEDTSKEPSLSTQTLPVIKCSGQTSRLSASSTFQSISDSLLAVS P


    Database link: Q14679

  • Positive control
    • HeLa, 293T, and Jurkat whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab186045 was affinity purified using an epitope specific to TTLL4 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab186045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/1000 - 1/5000. Predicted molecular weight: 133 kDa.

Target

  • Function
    Polyglutamylase which preferentially modifies beta-tubulin and nucleosome assembly proteins NAP1 and NAP2. Involved in the side-chain initiation step of the polyglutamylation reaction rather than in the elongation step.
  • Sequence similarities
    Belongs to the tubulin--tyrosine ligase family.
    Contains 1 TTL domain.
  • Cellular localization
    Cell projection > cilium. Cytoplasm > cytoskeleton > cilium basal body. Located in cilia. In some cells, also found in basal bodies.
  • Information by UniProt
  • Database links
  • Alternative names
    • TTLL4 antibody
    • TTLL4_HUMAN antibody
    • Tubulin polyglutamylase TTLL4 antibody
    • Tubulin--tyrosine ligase-like protein 4 antibody

Images

  • Detection of TTLL4 by Western Blot of Immunprecipitate.
    Lane 1: ab186045 at 1µg/ml staining TTLL4 in 293T whole cell lysate immunoprecipitated using ab186045 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).

    Lane 2: Control IgG

    Detection: Chemiluminescence with an exposure time of 3 minutes.
    Detection: Chemiluminescence with exposure time of 3 minutes.

     

  • All lanes : Anti-TTLL4 antibody - C-terminal (ab186045) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 133 kDa


    Exposure time: 3 minutes

References

ab186045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up